PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g60220.2.p
Common NameBRADI_3g60220, LOC100835240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 350aa    MW: 37220.9 Da    PI: 7.0321
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g60220.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-141462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd +l+ ++   G+g +W + ++++g++R++k+c++rw++yl
  Bradi3g60220.2.p 14 KGPWSPEEDAKLKAYIDDNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding391.9e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Bradi3g60220.2.p  69 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.333962IPR017930Myb domain
SuperFamilySSF466894.9E-2512109IPR009057Homeodomain-like
SMARTSM007176.8E-111364IPR001005SANT/Myb domain
PfamPF002491.7E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-231569IPR009057Homeodomain-like
CDDcd001674.93E-81662No hitNo description
PROSITE profilePS5129421.92463117IPR017930Myb domain
SMARTSM007172.9E-1067115IPR001005SANT/Myb domain
PfamPF002494.2E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2370117IPR009057Homeodomain-like
CDDcd001675.30E-771111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSPE EDAKLKAYID DNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEEHIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLGK  120
RAPSRRARTS LQLHDPQPPL HGMAAAGAGS AALSSSALER IQLHMRLQQA GLYSTAMPQW  180
APAPKLEATD AIAMTTTVST QQQQQQQQHI PDQSLLLNYS SSSAAELAAA EAACNGAAAE  240
MSSMAGNANA IAGFGSYGHV DELYDFLYSN HSAAAAVGAF EGGMTIPSLL PELHGGAAVV  300
GADEKFSAWT AAAASCGEFG TTTGGGQLQL HGSCDSINNL QDFVLGYDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573138.10.0PREDICTED: transcription factor MYB30-like
TrEMBLA0A0Q3FVD60.0A0A0Q3FVD6_BRADI; Uncharacterized protein
STRINGMLOC_58499.11e-129(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP1206146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-80myb domain protein 36